Nova Peptide SupplyProduct page includes use or preparation wordingIn stock
Cagrilintide · 10 mg × 1 vial
$89.99$9.00 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship
Research listings · GLP-1 research listings
Cagrilintide research listings: prices and suppliers
Research materials and consumer products belong to different categories. A listing, laboratory report, or research-use label does not establish suitability for personal use.
We have no commercial relationship with suppliers on this page. Offers are sorted by price per mg; commission never changes the order.
Prices observed weekly · last check · How we check prices →
Lowest current at 10 mg × 1 vial$9.00 / mg · $89.99Nova Peptide Supply · checked 5 days ago
Listings at 10 mg × 1 vial
| Supplier link | |||||||
|---|---|---|---|---|---|---|---|
| Nova Peptide SupplyProduct page includes use or preparation wording | 10 mg × 1 vial | $89.99 | $9.00 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Amino USAProduct page includes use or preparation wording | 10 mg × 1 vial | $102.00 | $10.20 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Direct PeptidesProduct page includes use or preparation wording | 10 mg × 1 vial | $109.00 | $10.90 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Protide Health | 10 mg × 1 vial | $155.00 | $15.50 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
- Amino USAProduct page includes use or preparation wordingIn stock
Cagrilintide · 10 mg × 1 vial
$102.00$10.20 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - Direct PeptidesProduct page includes use or preparation wordingIn stock
Cagrilintide · 10 mg × 1 vial
$109.00$10.90 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - Protide HealthIn stock
Cagrilintide · 10 mg × 1 vial
$155.00$15.50 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship
Out of stock · 1
The supplier showed these as out of stock when we last checked.
| Supplier link | |||||||
|---|---|---|---|---|---|---|---|
| PeptidePlugsProduct page includes use or preparation wording | 10 mg × 1 vial | $60.00 | $6.00 / mg | Out of stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
- PeptidePlugsProduct page includes use or preparation wordingOut of stock
Cagrilintide · 10 mg × 1 vial
$60.00$6.00 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship
- Prices exclude shipping. A matching name does not verify the contents of a lot.
- Lab reports are vendor-reported, not independently authenticated. “Lab confirmed” means the issuing laboratory confirmed the report is theirs.
- Some suppliers’ product pages include use or preparation wording. We list their prices for comparison only; we do not endorse that wording, and nothing on this site is guidance on preparing or using these materials.
By size
Every package size we track for Cagrilintide. Current means seen in the last 8 days.
| 5 mg × 1 vial | $57.00 | $11.40 / mg | 2 / 2 | 2 |
|---|---|---|---|---|
| 10 mg × 1 vial | $89.99 | $9.00 / mg | 4 / 5 | 4 |
| 10 mg × 10 vials | $979.00 | $9.79 / mg | 1 / 1 | 1 |
Research context
From our own records, with the date each was last checked.
- FDA approval
- No approved drug product with this ingredient listed in Drugs@FDA (data updated 2026-11-02)Checked
- 503A / 503B compounding
- Not in any 503A category on FDA's 2026-05-14 listChecked
- Advisory committee (PCAC)
- No PCAC meeting on cagrilintide found on FDA's 2022 to 2027 PCAC meeting pages (checked 2026-11-03)Checked
- Rulemaking / enforcement
- No Federal Register document found for cagrilintide (search on 2026-11-03)Checked
- Identity
- Formula C194H312N54O59S2 · MW 4409 g/mol · CAS 1415456-99-3Sequence XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (PubChem notation; X marks a non-standard group)Source record Checked
Identity noteNot the combination CagriSema. Some suppliers list it under short or code names such as Cagri or AP-AMR1.
How we check prices · Offers are matched to our catalogue by an editor before they appear; a listing is not an endorsement.