Swiss ChemsProduct page includes use or preparation wordingIn stock
IGF-1 LR3 · 1 mg × 1 vial
$59.96$59.96 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship
Research listings · Peptides
IGF-1 LR3 research listings: prices and suppliers
Research materials and consumer products belong to different categories. A listing, laboratory report, or research-use label does not establish suitability for personal use.
We have no commercial relationship with suppliers on this page. Offers are sorted by price per mg; commission never changes the order.
Prices observed weekly · last check · How we check prices →
Lowest current at 1 mg × 1 vial$59.96 / mg · $59.96Swiss Chems · checked 5 days ago
Listings at 1 mg × 1 vial
| Supplier link | |||||||
|---|---|---|---|---|---|---|---|
| Swiss ChemsProduct page includes use or preparation wording | 1 mg × 1 vial | $59.96 | $59.96 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Amino USAProduct page includes use or preparation wording | 1 mg × 1 vial | $70.00 | $70.00 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| PeptidePlugsProduct page includes use or preparation wording | 1 mg × 1 vial | $70.00 | $70.00 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Nova Peptide SupplyProduct page includes use or preparation wording | 1 mg × 1 vial | $79.99 | $79.99 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| American PeptidesProduct page includes use or preparation wording | 1 mg × 1 vial | $85.00 | $85.00 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Protide Health | 1 mg × 1 vial | $85.00 | $85.00 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Sports Technology LabsProduct page includes use or preparation wording | 1 mg × 1 vial | $134.99 | $134.99 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Biotech PeptidesProduct page includes use or preparation wording | 1 mg × 1 vial | $145.00 | $145.00 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Core PeptidesProduct page includes use or preparation wording | 1 mg × 1 vial | $150.00 | $150.00 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
- Amino USAProduct page includes use or preparation wordingIn stock
IGF-1 LR3 · 1 mg × 1 vial
$70.00$70.00 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - PeptidePlugsProduct page includes use or preparation wordingIn stock
IGF-1 LR3 · 1 mg × 1 vial
$70.00$70.00 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - Nova Peptide SupplyProduct page includes use or preparation wordingIn stock
IGF-1 LR3 · 1 mg × 1 vial
$79.99$79.99 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - American PeptidesProduct page includes use or preparation wordingIn stock
IGF-1 LR3 · 1 mg × 1 vial
$85.00$85.00 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - Protide HealthIn stock
IGF-1 LR3 · 1 mg × 1 vial
$85.00$85.00 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - Sports Technology LabsProduct page includes use or preparation wordingIn stock
IGF-1 LR3 · 1 mg × 1 vial
$134.99$134.99 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - Biotech PeptidesProduct page includes use or preparation wordingIn stock
IGF-1 LR3 · 1 mg × 1 vial
$145.00$145.00 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - Core PeptidesProduct page includes use or preparation wordingIn stock
IGF-1 LR3 · 1 mg × 1 vial
$150.00$150.00 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship
Out of stock · 1
The supplier showed these as out of stock when we last checked.
| Supplier link | |||||||
|---|---|---|---|---|---|---|---|
| Direct PeptidesProduct page includes use or preparation wording | 1 mg × 1 vial | $109.00 | $109.00 / mg | Out of stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
- Direct PeptidesProduct page includes use or preparation wordingOut of stock
IGF-1 LR3 · 1 mg × 1 vial
$109.00$109.00 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship
- Prices exclude shipping. A matching name does not verify the contents of a lot.
- Lab reports are vendor-reported, not independently authenticated. “Lab confirmed” means the issuing laboratory confirmed the report is theirs.
- Some suppliers’ product pages include use or preparation wording. We list their prices for comparison only; we do not endorse that wording, and nothing on this site is guidance on preparing or using these materials.
By size
Every package size we track for IGF-1 LR3. Current means seen in the last 8 days.
| 100 mcg × 1 vial | $27.00 | $270.00 / mg | 2 / 2 | 2 |
|---|---|---|---|---|
| 1 mg × 1 vial | $59.96 | $59.96 / mg | 9 / 10 | 9 |
| 1 mg × 10 vials | — | — | 0 / 1 | 0 |
Research context
From our own records, with the date each was last checked.
- FDA approval
- No approved drug product with this ingredient listed in Drugs@FDA (data updated 2026-11-02)Checked
- 503A / 503B compounding
- Not in any 503A category on FDA's 2026-05-14 listChecked
- Advisory committee (PCAC)
- No PCAC meeting on IGF-1 LR3 found on FDA's 2022 to 2027 PCAC meeting pages (checked 2026-11-03)Checked
- Rulemaking / enforcement
- No Federal Register document found for IGF-1 LR3 (search on 2026-11-03)Checked
- WADA
- S2.3 Growth factors and growth factor modulators · Prohibited at all times — in and out of competition (2026 list; unchanged in the 2027 list, in force from Jan 1, 2027)Checked
- Identity
- MW about 9.1 kDa · CAS 143045-27-6Sequence MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSASource record Checked
Identity noteNot mecasermin (Increlex), the FDA-approved IGF-1 product, and not IGF-1 DES.
How we check prices · Offers are matched to our catalogue by an editor before they appear; a listing is not an endorsement.