Ascension PeptidesProduct page includes use or preparation wordingIn stock
LL-37 · 10 mg × 1 vial
$78.00$7.80 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship
Research listings · Peptides
LL-37 research listings: prices and suppliers
Research materials and consumer products belong to different categories. A listing, laboratory report, or research-use label does not establish suitability for personal use.
We have no commercial relationship with suppliers on this page. Offers are sorted by price per mg; commission never changes the order.
Prices observed weekly · last check · How we check prices →
Lowest current at 10 mg × 1 vial$7.80 / mg · $78.00Ascension Peptides · checked 5 days ago
Listings at 10 mg × 1 vial
| Supplier link | |||||||
|---|---|---|---|---|---|---|---|
| Ascension PeptidesProduct page includes use or preparation wording | 10 mg × 1 vial | $78.00 | $7.80 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
- Prices exclude shipping. A matching name does not verify the contents of a lot.
- Lab reports are vendor-reported, not independently authenticated. “Lab confirmed” means the issuing laboratory confirmed the report is theirs.
- Some suppliers’ product pages include use or preparation wording. We list their prices for comparison only; we do not endorse that wording, and nothing on this site is guidance on preparing or using these materials.
By size
Every package size we track for LL-37. Current means seen in the last 8 days.
| 5 mg × 1 vial | $51.48 | $10.30 / mg | 7 / 7 | 7 |
|---|---|---|---|---|
| 10 mg × 1 vial | $78.00 | $7.80 / mg | 1 / 1 | 1 |
Research context
From our own records, with the date each was last checked.
- FDA approval
- No approved drug product with this ingredient listed in Drugs@FDA (data updated 2026-11-02)Checked
- 503A / 503B compounding
- Formerly 503A category 2 (as cathelicidin LL-37); nominations withdrawn. Not in any 503A category on FDA's 2026-05-14 listChecked
- Advisory committee (PCAC)
- FDA plans to discuss cathelicidin (LL-37) for the 503A list at a PCAC meeting before the end of February 2027Checked
- Rulemaking / enforcement
- No FDA document found in the Federal Register for LL-37 (search on 2026-11-03); the only matches are NIH licensing notices from 2000 to 2002Checked
- Identity
- Formula C205H340N60O53 · MW 4493 g/mol · CAS 154947-66-7Sequence LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESSource record Checked
Identity noteLL-37 is residues 134 to 170 of the human precursor protein hCAP18 (UniProt P49913). Some listings add the name CAP-18, which properly refers to the precursor.
How we check prices · Offers are matched to our catalogue by an editor before they appear; a listing is not an endorsement.