Biotech PeptidesProduct page includes use or preparation wordingIn stock
Sermorelin · 5 mg × 1 vial
$43.00$8.60 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship
Research listings · Peptides
Sermorelin research listings: prices and suppliers
Research materials and consumer products belong to different categories. A listing, laboratory report, or research-use label does not establish suitability for personal use.
We have no commercial relationship with suppliers on this page. Offers are sorted by price per mg; commission never changes the order.
Prices observed weekly · last check · How we check prices →
Lowest current at 5 mg × 1 vial$8.60 / mg · $43.00Biotech Peptides · checked 5 days ago
Listings at 5 mg × 1 vial
| Supplier link | |||||||
|---|---|---|---|---|---|---|---|
| Biotech PeptidesProduct page includes use or preparation wording | 5 mg × 1 vial | $43.00 | $8.60 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Peak Lab PeptidesProduct page includes use or preparation wording | 5 mg × 1 vial | $45.68 | $9.14 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Core PeptidesProduct page includes use or preparation wording | 5 mg × 1 vial | $48.00 | $9.60 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Direct PeptidesProduct page includes use or preparation wording | 5 mg × 1 vial | $49.00 | $9.80 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Nova Peptide SupplyProduct page includes use or preparation wording | 5 mg × 1 vial | $49.99 | $10.00 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Sports Technology LabsProduct page includes use or preparation wording | 5 mg × 1 vial | $51.99 | $10.40 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Ascend ScienceProduct page includes use or preparation wording | 5 mg × 1 vial | $55.00 | $11.00 / mg | Stock unknown | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Protide Health | 5 mg × 1 vial | $55.00 | $11.00 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| Stealth Research LabsProduct page includes use or preparation wording | 5 mg × 1 vial | $59.99 | $12.00 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
| American PeptidesProduct page includes use or preparation wording | 5 mg × 1 vial | $60.00 | $12.00 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
- Peak Lab PeptidesProduct page includes use or preparation wordingIn stock
Sermorelin · 5 mg × 1 vial
$45.68$9.14 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - Core PeptidesProduct page includes use or preparation wordingIn stock
Sermorelin · 5 mg × 1 vial
$48.00$9.60 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - Direct PeptidesProduct page includes use or preparation wordingIn stock
Sermorelin · 5 mg × 1 vial
$49.00$9.80 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - Nova Peptide SupplyProduct page includes use or preparation wordingIn stock
Sermorelin · 5 mg × 1 vial
$49.99$10.00 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - Sports Technology LabsProduct page includes use or preparation wordingIn stock
Sermorelin · 5 mg × 1 vial
$51.99$10.40 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - Ascend ScienceProduct page includes use or preparation wordingStock unknown
Sermorelin · 5 mg × 1 vial
$55.00$11.00 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - Protide HealthIn stock
Sermorelin · 5 mg × 1 vial
$55.00$11.00 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - Stealth Research LabsProduct page includes use or preparation wordingIn stock
Sermorelin · 5 mg × 1 vial
$59.99$12.00 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship - American PeptidesProduct page includes use or preparation wordingIn stock
Sermorelin · 5 mg × 1 vial
$60.00$12.00 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship
- Prices exclude shipping. A matching name does not verify the contents of a lot.
- Lab reports are vendor-reported, not independently authenticated. “Lab confirmed” means the issuing laboratory confirmed the report is theirs.
- Some suppliers’ product pages include use or preparation wording. We list their prices for comparison only; we do not endorse that wording, and nothing on this site is guidance on preparing or using these materials.
By size
Every package size we track for Sermorelin. Current means seen in the last 8 days.
| 2 mg × 1 vial | $25.95 | $12.98 / mg | 2 / 2 | 2 |
|---|---|---|---|---|
| 5 mg × 1 vial | $43.00 | $8.60 / mg | 10 / 10 | 9 |
| 10 mg × 1 vial | $45.00 | $4.50 / mg | 3 / 5 | 3 |
| 15 mg × 1 vial | $100.00 | $6.67 / mg | 1 / 1 | 1 |
| 5 mg × 10 vials | $408.00 | $8.16 / mg | 2 / 2 | 2 |
Research context
From our own records, with the date each was last checked.
- FDA approval
- Geref (sermorelin acetate) was approved under NDAs 019863 (1990-12-28) and 020443 (1997-09-26); both discontinued, approvals withdrawn at the holder's request effective 2009-06-18Checked
- 503A / 503B compounding
- Not in any 503A category on FDA's 2026-05-14 listChecked
- Advisory committee (PCAC)
- No PCAC meeting on sermorelin found on FDA's 2022 to 2027 PCAC meeting pages (checked 2026-11-03)Checked
- Rulemaking / enforcement
- No FDA rule found (search on 2026-11-03); matching rules are CMS Medicare payment rules with a sermorelin billing code. A 2013-03-04 FDA notice: Geref not withdrawn for safety or effectivenessChecked
- WADA
- S2.2.4 Growth hormone releasing factors: GHRH and its analogues · Prohibited at all times — in and out of competition (2026 list; unchanged in the 2027 list, in force from Jan 1, 2027)Checked
- Identity
- Formula C149H246N44O42S · MW 3357.9 g/mol · CAS 86168-78-7Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2Source record Checked
Identity noteNot the same molecule as CJC-1295 without DAC (modified GRF 1-29), which differs at four positions. Research listings are not FDA-approved medicines.
How we check prices · Offers are matched to our catalogue by an editor before they appear; a listing is not an endorsement.