Amino USAProduct page includes use or preparation wordingIn stock
VIP (vasoactive intestinal peptide) · 5 mg × 1 vial
$48.00$9.60 / mg
Checked · 5 days ago
Lab report: Not linked
View product details (opens in a new tab)No commercial relationship
Research listings · Peptides
VIP (vasoactive intestinal peptide) research listings: prices and suppliers
Research materials and consumer products belong to different categories. A listing, laboratory report, or research-use label does not establish suitability for personal use.
We have no commercial relationship with suppliers on this page. Offers are sorted by price per mg; commission never changes the order.
Prices observed weekly · last check · How we check prices →
Lowest current at 5 mg × 1 vial$9.60 / mg · $48.00Amino USA · checked 5 days ago
Listings at 5 mg × 1 vial
| Supplier link | |||||||
|---|---|---|---|---|---|---|---|
| Amino USAProduct page includes use or preparation wording | 5 mg × 1 vial | $48.00 | $9.60 / mg | In stock | 5 d ago | Not linked | View product details (opens in a new tab)No commercial relationship |
- Prices exclude shipping. A matching name does not verify the contents of a lot.
- Lab reports are vendor-reported, not independently authenticated. “Lab confirmed” means the issuing laboratory confirmed the report is theirs.
- Some suppliers’ product pages include use or preparation wording. We list their prices for comparison only; we do not endorse that wording, and nothing on this site is guidance on preparing or using these materials.
By size
Every package size we track for VIP (vasoactive intestinal peptide). Current means seen in the last 8 days.
| 5 mg × 1 vial | $48.00 | $9.60 / mg | 1 / 1 | 1 |
|---|---|---|---|---|
| 10 mg × 1 vial | $58.00 | $5.80 / mg | 3 / 3 | 3 |
| 10 mg × 10 vials | $799.00 | $7.99 / mg | 1 / 1 | 1 |
Research context
From our own records, with the date each was last checked.
- FDA approval
- No approved drug product with this ingredient listed in Drugs@FDA (searched as aviptadil and vasoactive intestinal peptide; data updated 2026-11-02)Checked
- 503A / 503B compounding
- 503A category 1 (under evaluation) on FDA's 2026-05-14 listChecked
- Advisory committee (PCAC)
- PCAC voted on 2016-11-03 not to include VIP on the 503A list, as FDA had proposed (use reviewed: chronic inflammatory response syndrome)Checked
- Rulemaking / enforcement
- FDA proposed in 2019 not to place VIP on the 503A bulks list; no final rule found (search on 2026-11-03)Checked
- Identity
- Formula C147H238N44O42S · MW 3325.8 g/mol · CAS 40077-57-4Sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2Source record Checked
Identity noteVIP ends in an amidated asparagine. FDA's substance registry records aviptadil with this C-terminal amide; PubChem's record filed under the name aviptadil shows a free acid instead.
How we check prices · Offers are matched to our catalogue by an editor before they appear; a listing is not an endorsement.